CookSnap is coming soon — Join the waitlist →
Back to recipes

Curry Paste Fried Rice Bowl with Crispy Egg

Thai-style fried rice loaded with curry paste, mixed protein, and topped with a crispy egg. Served with steamed rice, cooling cucumber slices, and a runny yolk for dipping.

Total time
25 min
Servings
2
Calories
520
Protein
28g
Curry Paste Fried Rice Bowl with Crispy Egg
satisfyingboldthaichickenshrimpcrispytenderweeknight

Ingredients

  • 3 tbsp red curry paste
  • 300 g mixed protein (diced chicken, shrimp, or pork)
  • 2 cups cooked jasmine rice, cold
  • 2 whole eggs
  • 1 tbsp fish sauce
  • ½ whole cucumber, sliced
  • 3 tbsp neutral oil
  • ½ whole lime

Instructions

  1. 1

    Heat 2 tbsp oil in a large skillet over medium-high until it shimmers, ~90 seconds.

  2. 2

    Add curry paste to the oil and stir constantly until fragrant, ~2 minutes. Break it up with the spoon.

  3. 3

    Add diced protein and cook, stirring, until no pink remains, ~6 minutes. Break pieces as they cook.

  4. 4

    Stir in cold rice, breaking up clumps. Add fish sauce and toss until rice is warm and coated, ~4 minutes.

  5. 5

    Push rice to the side. Add 1 tbsp oil to the empty space and crack in 2 eggs. Fry until whites set but yolks jiggle, ~3 minutes.

  6. 6

    Divide rice between bowls. Top each with a fried egg. Serve with cucumber slices and lime wedges on the side.

Tools you’ll need

  • 12-inch skillet or wok
  • wooden spoon or spatula
  • 2 bowls
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.