Custrd is out on the App Store — Download it free →
Back to recipes

20-Min Nasi Lemak Bowl with Crispy Chicken & Fish

Fragrant coconut rice topped with fried chicken, crispy fish, spicy sambal, and a runny egg — a Malaysian street-food classic that feels fancy but takes 20 minutes flat.

Total time
20 min
Servings
2
Calories
685
Protein
42g
20-Min Nasi Lemak Bowl with Crispy Chicken & Fish
satisfyingboldmalaysianchickenfishcrispyfluffytender

Ingredients

  • 1.5 cups cooked jasmine or long-grain rice
  • ½ cup coconut milk
  • ¾ lb chicken thighs, boneless and skinless, cut into 1-inch pieces
  • ½ lb firm white fish (cod or tilapia), cut into 2-inch chunks
  • 3 tbsp sambal oelek or sriracha
  • 2 whole large eggs
  • 3 tbsp neutral oil
  • 1 whole fresh lime (halved) and fresh cilantro or scallions, chopped

Instructions

  1. 1

    Heat 1 tbsp oil in a large skillet over medium-high. Add chicken, season with salt and pepper, and cook stirring occasionally until golden and cooked through, 6–7 minutes. Transfer to a plate.

  2. 2

    In the same skillet, add 1 tbsp oil. Sear fish pieces without moving for 2 minutes per side until edges are golden and flaky. Season with salt. Transfer to the plate with chicken.

  3. 3

    Warm the cooked rice with coconut milk and a pinch of salt in the skillet, stirring gently, for 2 minutes until fragrant and heated through.

  4. 4

    Push rice to the side, add 1 tbsp oil, and crack both eggs into the skillet. Fry until whites set but yolks still jiggle, 3–4 minutes.

  5. 5

    Divide rice between two bowls. Top each with chicken, fish, a fried egg, and 1.5 tbsp sambal. Squeeze lime over the top and scatter cilantro.

Tools you’ll need

  • large skillet (12-inch minimum)
  • plate
  • two bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.