Custrd is out on the App Store — Download it free →
Back to recipes

Curried Chicken with Rice

A quick and comforting weeknight dinner of tender chicken pieces in a fragrant curry sauce, served over fluffy rice. Ready in about 20 minutes with simple pantry staples.

Total time
20 min
Servings
4
Calories
550
Protein
35g
Curried Chicken with Rice
comfortingIndian-inspiredgluten-freechickencreamytenderweeknightmain course

Ingredients

  • 1.5 lb chicken breast
  • 2 tbsp curry powder
  • 1 medium onion
  • 2 cloves garlic
  • 1 can (13.5 oz) coconut milk
  • 3 cups cooked rice

Instructions

  1. 1

    Cut the 1.5 lb chicken breast into bite-sized pieces and season with salt and pepper. Heat 1 tbsp oil in a large skillet over medium-high heat.

  2. 2

    Add the chicken and cook until browned on all sides, about 5 minutes. Remove chicken to a plate and set aside.

  3. 3

    In the same skillet, add the 1 sliced onion and 2 minced garlic cloves. Cook over medium until soft, about 3 minutes.

  4. 4

    Stir in the 2 tbsp curry powder and cook for 1 minute until fragrant. Pour in the 1 can coconut milk and bring to a simmer.

  5. 5

    Return the chicken to the skillet and simmer until the sauce thickens slightly and chicken is cooked through, about 5 minutes. Serve over the 3 cups cooked rice, garnished with fresh herbs if desired.

Tools you’ll need

  • Large skillet
  • Cutting board
  • Knife
  • Wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.