Custrd is out on the App Store — Download it free →
Back to recipes

Buffalo Chicken Stuffed Sweet Potato

A hearty baked sweet potato loaded with spicy buffalo chicken and topped with creamy blue cheese dressing, served with sautéed green beans and mushrooms.

Total time
40 min
Servings
2
Calories
550
Protein
38g
Buffalo Chicken Stuffed Sweet Potato
comfortingAmericangluten-freechickencreamytenderweeknightmain course

Ingredients

  • 2 medium sweet potatoes
  • 1 lb chicken breast
  • ½ cup buffalo sauce
  • ¼ cup blue cheese dressing
  • 2 cups green beans
  • 1 cup mushrooms
  • 2 tbsp olive oil
  • ½ tsp salt

Instructions

  1. 1

    Preheat oven to 400°F. Pierce the 2 sweet potatoes with a fork and microwave on high for 5 minutes to soften, then place on a baking sheet and roast for 20 minutes until tender when pierced.

  2. 2

    While potatoes cook, season the 1 lb chicken breast with 1/4 tsp salt. Heat 1 tbsp olive oil in a skillet over medium-high and cook chicken 6-7 minutes per side until golden and cooked through (no pink inside).

  3. 3

    Let chicken rest 5 minutes, then shred with two forks. Toss shredded chicken with 1/2 cup buffalo sauce until well coated.

  4. 4

    In the same skillet, heat remaining 1 tbsp olive oil over medium. Add 2 cups green beans and 1 cup sliced mushrooms, season with 1/4 tsp salt, and sauté 6-8 minutes until beans are bright green and tender-crisp.

  5. 5

    Split each sweet potato open and fluff the flesh. Divide the buffalo chicken between the two potatoes, then top each with 2 tbsp blue cheese dressing.

  6. 6

    Serve the stuffed potatoes alongside the sautéed green beans and mushrooms.

  7. 7

    Optional: sprinkle with chopped celery or extra blue cheese crumbles if you have them.

Tools you’ll need

  • baking sheet
  • skillet
  • fork
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.