CookSnap is coming soon — Join the waitlist →

Cumin Beef Skillet

Northeastern Chinese street-food beef seared with toasted cumin, soy, and garlic in one screaming-hot skillet. Ready in 15 minutes, tastes like takeout.

Total time
15 min
Servings
2
Calories
340
Protein
38g
Cumin Beef Skillet
quicksatisfyingchinesebeefcrispytenderweeknightmain-dish

Ingredients

  • 12 oz beef sirloin or flank steak, thinly sliced
  • 1 tbsp cumin seeds
  • 2 tbsp soy sauce
  • 3 whole scallions, chopped
  • ½ tsp chili flakes or Sichuan pepper (optional)
  • 3 cloves garlic, minced

Instructions

  1. 1

    Heat a dry 12-inch skillet over high heat for 1 minute. Add cumin seeds and toast for 30 seconds until fragrant, stirring constantly.

  2. 2

    Push cumin to the side. Add 1 tbsp oil and let it shimmer, about 30 seconds.

  3. 3

    Add beef in a single layer. Don't stir for 90 seconds—let it sear and brown deeply on the bottom.

  4. 4

    Stir in garlic and cook until fragrant, about 30 seconds. Pour in soy sauce and flakes if using.

  5. 5

    Toss everything for 1 minute until beef is cooked through and cumin coats every piece.

  6. 6

    Remove from heat. Top with scallions and serve immediately over rice.

Tools you’ll need

  • 12-inch heavy skillet (cast iron preferred)
  • wooden spoon or spatula
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.