15-Min Crispy Tuna Empanadas
Golden, flaky pastry pockets stuffed with Spanish-style tuna, peppers, and onions—ready in under 15 minutes with store-bought empanada wrappers. A TikTok-easy dinner that tastes like you spent hours.
- Total time
- 15 min
- Servings
- 2
- Calories
- 312
- Protein
- 16g
casualsatisfyingspanishfishcrispytenderflakyweeknight
Ingredients
- 1 can (5 oz), drained canned tuna in oil
- ½ medium red bell pepper, diced
- ¼ medium yellow onion, diced
- 3 tbsp pitted green olives, chopped
- 2 whole roasted red piquillo peppers, chopped
- 8 wrappers empanada wrappers
- 2 tbsp neutral cooking oil
Instructions
- 1
Mix tuna, diced pepper, onion, olives, and piquillo peppers in a bowl.
- 2
Place 2 tbsp filling in the center of each empanada wrapper, fold in half, and press edges to seal.
- 3
Heat oil in a large skillet over medium-high until shimmering, about 1 minute.
- 4
Fry empanadas 2 minutes per side until edges turn golden brown and crispy.
- 5
Transfer to a paper towel and let cool 1 minute before serving.
Tools you’ll need
- medium mixing bowl
- large skillet (10-inch minimum)
- paper towels
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
