CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Crispy Steak with Mashed Potatoes & Onions

Thin-sliced flank steak seared until crispy, served Colombian-style with creamy mashed potatoes, pickled red onions, and fresh lettuce. Comes together in 20 minutes.

Total time
20 min
Servings
2
Calories
620
Protein
52g
20-Min Crispy Steak with Mashed Potatoes & Onions
comfortsatisfyingcolombianbeefcrispytendercreamyweeknight

Ingredients

  • 1 lb flank steak, thinly sliced
  • 1 lb potatoes
  • ½ medium red onion, thinly sliced
  • 3 tbsp white vinegar
  • 3 tbsp butter
  • ½ cup beef broth
  • 2 cups fresh lettuce (any variety)

Instructions

  1. 1

    Dice potatoes into 1-inch cubes. Place in a pot of cold salted water and bring to boil.

  2. 2

    Toss red onion slices with vinegar and a pinch of salt in a small bowl. Let sit while you cook.

  3. 3

    Pat steak slices dry. Season generously with salt and black pepper on both sides.

  4. 4

    Heat 1 tbsp oil in a large skillet over medium-high until shimmering. Working in batches, sear steak 60 seconds per side until edges brown. Transfer to a plate.

  5. 5

    Pour broth into the pan, scraping up browned bits. Return steak to pan, toss to coat, then remove heat.

  6. 6

    Drain potatoes when fork-tender. Mash with 3 tbsp butter, a splash of milk, salt, and pepper until creamy.

  7. 7

    Arrange mashed potatoes, steak with pan sauce, pickled onions, and fresh lettuce on each plate. Serve hot.

Tools you’ll need

  • large skillet (12-inch)
  • medium pot
  • small mixing bowl
  • wooden spoon or spatula
  • potato masher
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.