CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Spinach & Feta Borek with Turkish Tea

Phyllo sheets stuffed with garlicky spinach and feta, baked until golden and shatteringly crisp. Served with Turkish tea, briny olives, and cool cucumbers for a complete Turkish spread.

Total time
18 min
Servings
2
Calories
385
Protein
12g
Crispy Spinach & Feta Borek with Turkish Tea
casualsatisfyingturkishvegetariancheesecrispyflakycreamy

Ingredients

  • 4 cups fresh spinach, roughly chopped
  • ¾ cup feta cheese, crumbled
  • 6 sheets phyllo sheets
  • 2 cloves garlic, minced
  • ⅓ cup olive oil, divided
  • 2 tbsp dill, chopped

Instructions

  1. 1

    Heat 1 tbsp olive oil in a large skillet over medium. Add minced garlic and cook 30 seconds until fragrant.

  2. 2

    Add spinach and cook, stirring, until wilted and any liquid has evaporated, about 3 minutes.

  3. 3

    Remove from heat. Fold in crumbled feta and dill, then season with salt and pepper.

  4. 4

    Lay one phyllo sheet on a work surface, brush lightly with olive oil, then place 2 tbsp spinach-feta mixture in the center.

  5. 5

    Fold the phyllo into a triangle or envelope, sealing the edges. Repeat with remaining sheets and filling.

  6. 6

    Place boreks on a sheet pan, brush tops with remaining oil, and bake at 400°F until golden and crispy, 8–10 minutes.

  7. 7

    Serve hot with Turkish tea, green olives, and fresh cucumber slices on the side.

Tools you’ll need

  • large skillet
  • sheet pan
  • pastry brush
  • oven (preheated to 400°F)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.