CookSnap is coming soon — Join the waitlist →
Back to recipes

Su Böreği (Turkish Cheese Pastry)

Delicate phyllo sheets layered with creamy cheese filling and baked until golden, then drizzled with hot butter infused with fresh herbs. A stunning vegetarian showpiece that looks restaurant-quality but requires just 8 ingredients.

Total time
40 min
Servings
4
Calories
545
Protein
16g
Su Böreği (Turkish Cheese Pastry)
elegantsatisfyingturkishvegetariancheesecrispycreamyflaky

Ingredients

  • 1 package (about 12 sheets, 1 lb) phyllo dough sheets (thawed if frozen)
  • 1.5 cups ricotta cheese
  • ¾ cup feta cheese, crumbled
  • ¼ cup fresh parsley, finely chopped
  • 2 tablespoons fresh dill, finely chopped
  • ¾ cup butter, divided
  • ½ teaspoon salt
  • ¼ teaspoon black pepper

Instructions

  1. 1

    Set the oven to 350°F and wait until the indicator light or beep signals it has fully preheated, about 10 minutes.

  2. 2

    In a large bowl, combine ricotta, feta, parsley, dill, salt, and pepper, stirring with a fork until evenly mixed.

  3. 3

    Melt 2 tablespoons of butter in a small saucepan over low heat, watching until it turns liquid and smooth.

  4. 4

    Lay one phyllo sheet on a clean, dry work surface and brush it lightly with melted butter using a pastry brush, covering the whole surface with a thin, even coat.

  5. 5

    Lay a second phyllo sheet directly on top of the buttered one and brush it with butter in the same way.

  6. 6

    Spread 3 tablespoons of cheese filling across the lower half of the stacked phyllo sheets, leaving a 1-inch border on the left, right, and bottom edges.

  7. 7

    Fold the left edge of phyllo over the filling by 1 inch, then fold the right edge over by 1 inch, pressing gently so they overlap slightly.

  8. 8

    Starting at the bottom edge where the filling is, roll the phyllo tightly away from you like a small log, tucking in the sides as you roll to seal the cheese inside.

  9. 9

    Place the rolled pastry seam-side down on a parchment-lined 9-by-13-inch baking sheet and repeat steps 4–8 with remaining phyllo sheets and filling to make 5 rolls total.

  10. 10

    Brush the top and sides of each roll with remaining melted butter, using about 1 teaspoon per roll, until all rolls look glossy and moist.

  11. 11

    Slide the baking sheet into the preheated oven and bake for 20–25 minutes until the pastry is golden brown on top and feels firm when pressed lightly.

  12. 12

    Remove the pastry from the oven and let it rest on the sheet for 2 minutes so the cheese sets slightly before serving.

Tools you’ll need

  • oven
  • large mixing bowl
  • fork
  • small saucepan
  • pastry brush
  • work surface or cutting board
  • parchment-lined 9-by-13-inch baking sheet

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.