CookSnap is coming soon — Join the waitlist →

Crispy Spinach & Cheese Börek

Flaky phyllo wrapped around spiced spinach and feta, pan-fried until golden and shattering crisp. Turkish street food in 25 minutes.

Total time
25 min
Servings
2
Calories
385
Protein
12g
Crispy Spinach & Cheese Börek
crispysatisfyingturkishvegetariancheesecrispyflakycreamy

Ingredients

  • 5 cups fresh spinach, roughly chopped
  • ¾ cup feta cheese, crumbled
  • 8 sheets phyllo dough sheets
  • ¼ medium yellow onion, minced
  • 1 tsp dried dill
  • ¼ tsp nutmeg, ground
  • 4 tbsp olive oil, divided

Instructions

  1. 1

    Heat 1 tbsp olive oil in a large skillet over medium-high heat. Add minced onion, cook 1 minute until fragrant.

  2. 2

    Add spinach, dill, and nutmeg. Stir continuously for 2–3 minutes until spinach wilts and any liquid evaporates.

  3. 3

    Remove pan from heat. Stir in crumbled feta and let cool 2 minutes, then divide filling into 4 portions.

  4. 4

    Layer 2 phyllo sheets, brush lightly with olive oil between them. Spread 1 portion filling on one short edge.

  5. 5

    Roll tightly into a log, tucking sides in as you go. Repeat with remaining phyllo, oil, and filling for 4 börek.

  6. 6

    Wipe skillet clean. Heat 2 tbsp olive oil over medium heat. Pan-fry börek 3–4 minutes per side until deep golden.

Tools you’ll need

  • large skillet
  • wooden spoon
  • pastry brush
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.