CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Spinach & Feta Borek

Buttery phyllo wrapped around seasoned spinach and crumbly feta, pan-fried until golden and shatteringly crisp. Turkish comfort food that feels fancy but takes 20 minutes.

Total time
20 min
Servings
2
Calories
385
Protein
12g
Crispy Spinach & Feta Borek
comfortelegantturkishvegetariancheesecrispyflakyweeknight

Ingredients

  • 4 cups fresh spinach, chopped
  • ¾ cup feta cheese, crumbled
  • 6 sheets phyllo dough sheets
  • 4 tbsp butter, melted
  • ¼ cup onion, minced
  • 2 tbsp fresh dill, chopped

Instructions

  1. 1

    Heat 1 tbsp butter in a large skillet over medium. Add minced onion and cook until soft, about 2 minutes.

  2. 2

    Add spinach and stir constantly until wilted and any moisture evaporates, about 3 minutes. Remove from heat.

  3. 3

    Fold feta and fresh dill into the spinach mixture. Season with salt and pepper to taste. Let cool 2 minutes.

  4. 4

    Lay one phyllo sheet on a cutting board. Brush lightly with melted butter. Spoon 2 tbsp spinach mixture along one short edge.

  5. 5

    Roll the phyllo tightly around the filling into a log. Repeat with remaining sheets and filling to make 6 boreks.

  6. 6

    Heat remaining 3 tbsp butter in the same skillet over medium-high. Fry boreks 2–3 minutes per side until golden and crisp. Serve immediately.

Tools you’ll need

  • large skillet (10–12 inch)
  • cutting board
  • spoon
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Turkish recipes →