CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Sopes with Shredded Beef Tinga

Crispy fried masa cups loaded with tangy chipotle-tomato shredded beef, topped with crema and fresh onion. Authentic Mexican comfort that's ready in 25 minutes.

Total time
25 min
Servings
4
Calories
385
Protein
22g
Crispy Sopes with Shredded Beef Tinga
comfortcasualmexicanbeefcrispytenderweeknightdinner

Ingredients

  • 1 lb prepared masa for sopes (corn dough, pre-made)
  • 1.5 cups shredded cooked beef (rotisserie or canned)
  • ¾ can (10 oz) canned diced tomatoes with green chiles
  • 2 whole peppers, minced chipotle peppers in adobo sauce
  • ½ cup Mexican crema or sour cream
  • ¼ medium onion yellow onion, minced
  • ½ cup queso fresco or cotija cheese, crumbled

Instructions

  1. 1

    Heat 1/4 inch neutral oil in a large skillet over medium-high until it shimmers, ~2 minutes.

  2. 2

    Divide masa into 8 balls and gently press into shallow cups (2 to 3 inches across, thin walls). Fry 2 to 3 minutes per side until edges are golden and crispy.

  3. 3

    Remove sopes with a slotted spoon and drain on paper towels, tilting to release excess oil.

  4. 4

    Combine shredded beef, diced tomatoes with chiles, minced chipotle, and salt and pepper to taste in a bowl. Stir until warm throughout.

  5. 5

    Divide beef mixture among sopes. Top each with a dollop of crema, minced onion, and crumbled cheese. Serve immediately.

Tools you’ll need

  • large skillet or griddle (12-inch)
  • slotted spoon
  • paper towels
  • mixing bowl
  • serving spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.