Custrd is out on the App Store — Download it free →
Back to recipes

Crispy Snow Cheese Fried Chicken

Juicy Korean fried chicken coated in a tangy-sweet cheese powder sauce, ready in 20 minutes. Serve with a creamy dipping sauce for that signature snow cheese vibe.

Total time
20 min
Servings
2
Calories
620
Protein
48g
Crispy Snow Cheese Fried Chicken
indulgentcasualkoreanchickencrispytendercreamyweeknight

Ingredients

  • 1 lb boneless, skinless chicken thighs
  • ½ cup all-purpose flour
  • ¾ cup grated mozzarella cheese
  • ½ cup sour cream
  • 2 tbsp honey
  • 1 tbsp white vinegar

Instructions

  1. 1

    Pat chicken dry and season with salt and pepper. Toss with flour until coated.

  2. 2

    Heat 2 tbsp neutral oil in a large skillet over medium-high until shimmering.

  3. 3

    Add chicken and sear 6–7 minutes per side until golden and cooked through. Remove to a plate.

  4. 4

    In the same pan, reduce heat to medium and whisk together sour cream, honey, and vinegar until smooth.

  5. 5

    Stir in mozzarella off heat until melted and glossy. Return chicken to coat in sauce.

  6. 6

    Serve immediately with extra sauce on the side for dipping.

Tools you’ll need

  • 12-inch skillet
  • paper towels
  • whisk
  • kitchen thermometer (optional)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.