CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Shrimp Bánh Khot

Golden-crispy Vietnamese shrimp pancakes with turmeric batter, topped with fresh herbs and tangy fish sauce dip. Pan-fried until the edges curl and the bottom crisps, ready in under 30 minutes.

Total time
25 min
Servings
2
Calories
380
Protein
22g
Crispy Shrimp Bánh Khot
casualfreshvietnameseshrimpcrispytenderweeknightdate-night

Ingredients

  • ¾ cup rice flour
  • 1 tsp turmeric powder
  • ¾ cup coconut milk
  • ½ lb shrimp, peeled and deveined
  • 3 tbsp fish sauce
  • 2 tbsp fresh lime juice
  • ¼ cup green onion, thinly sliced
  • ½ cup fresh cilantro and mint leaves, chopped

Instructions

  1. 1

    Whisk rice flour, turmeric, and salt together, then stir in coconut milk and 0.25 cup water until smooth batter forms.

  2. 2

    Mix fish sauce and lime juice in a small bowl for dipping sauce; set aside.

  3. 3

    Heat 2 tbsp oil in a 10-inch nonstick skillet over medium-high until shimmering, about 90 seconds.

  4. 4

    Pour half the batter into the skillet and arrange half the shrimp on top. Let cook undisturbed for 3–4 minutes until bottom edges turn golden and crispy.

  5. 5

    Flip the pancake carefully, cook another 1–2 minutes until the second side is light golden. Transfer to a plate and repeat with remaining batter and shrimp.

  6. 6

    Top pancakes with green onion and fresh herbs, drizzle with fish sauce dip, and serve hot.

Tools you’ll need

  • 10-inch nonstick skillet
  • whisk
  • small bowl
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.