CookSnap is coming soon — Join the waitlist →

Crispy Shrimp Banh Xeo

Golden, lacy Vietnamese crepes stuffed with shrimp, fresh herbs, and lettuce. Crispy on the outside, tender inside, and ready in under 25 minutes.

Total time
25 min
Servings
2
Calories
385
Protein
18g
Crispy Shrimp Banh Xeo
casualfreshvietnameseshrimpcrispytenderweeknightcrepe

Ingredients

  • ¾ cup all-purpose flour
  • ¾ cup coconut milk
  • ½ lb shrimp, peeled and deveined
  • 2 tablespoon fish sauce
  • 3 tablespoon butter
  • 2 cups lettuce and fresh herbs (mint, cilantro, or basil), plus lime wedges for serving

Instructions

  1. 1

    In a medium mixing bowl, whisk together 0.75 cup flour, 0.75 cup coconut milk, 1 tablespoon fish sauce, and 0.25 cup water until completely smooth with no lumps, about 1 minute.

  2. 2

    Pat the 0.5 lb shrimp dry with paper towels, then season with salt and pepper so they are evenly coated.

  3. 3

    Heat a 10-inch nonstick skillet over medium-high heat and add 1.5 tablespoons butter, swirling the pan until the butter is completely melted and foaming, about 30 seconds.

  4. 4

    Pour 0.5 cup batter into the center of the skillet, then immediately tilt and rotate the pan in a circular motion so the batter spreads evenly into a thin, lacy round, about 2 inches smaller than the pan edge.

  5. 5

    Arrange about 6 to 8 shrimp in a single line down the center of the crepe, then scatter 0.5 cup lettuce and herbs over the shrimp.

  6. 6

    Cook without moving the crepe until the bottom is deep golden brown and crispy, about 3 to 4 minutes; you'll hear a steady sizzle and smell toasted batter.

  7. 7

    Fold the crepe in half over the filling using a thin spatula or your fingers, pressing gently so it holds its shape, then slide it onto a plate.

  8. 8

    Wipe the pan with a paper towel, add the remaining 1.5 tablespoons butter, and repeat steps 4 through 7 to make the second crepe.

  9. 9

    Serve both crepes warm with lime wedges on the side; squeeze lime juice over each crepe just before eating.

Tools you’ll need

  • medium mixing bowl
  • whisk
  • paper towels
  • 10-inch nonstick skillet
  • thin spatula or offset spatula
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.