CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Seafood Banh Xeo (Vietnamese Sizzle Crepe)

Golden, lacy crepes stuffed with shrimp, squid, and crispy bean sprouts, served with lettuce and a tangy-sweet dipping sauce. Ready in under 25 minutes—the sizzle sound is half the fun.

Total time
25 min
Servings
2
Calories
420
Protein
24g
Crispy Seafood Banh Xeo (Vietnamese Sizzle Crepe)
casualsatisfyingvietnameseshrimpsquidcrispytendercrunchy

Ingredients

  • ¾ cup all-purpose flour
  • ½ lb shrimp, peeled and halved lengthwise
  • ¼ lb squid, cleaned and sliced into thin rings
  • 2 cups fresh bean sprouts
  • 3 tbsp fish sauce
  • 2 tbsp white sugar
  • 3 tbsp lime juice
  • 2 tbsp butter
  • 8 leaves lettuce leaves (butter or romaine)
  • ½ cup fresh herbs (cilantro and mint), chopped

Instructions

  1. 1

    Whisk flour with 1 cup water, a pinch of salt, and 1 tbsp fish sauce until smooth. Let sit 5 minutes.

  2. 2

    Mix remaining fish sauce, sugar, and lime juice with 3 tbsp water for dipping sauce. Set aside.

  3. 3

    Heat 1 tbsp butter in a 10-inch nonstick skillet over medium-high until foamy. Add half the shrimp and squid, cook 90 seconds per side until opaque.

  4. 4

    Push seafood to the edge of the skillet. Pour in half the batter, immediately tilt and swirl to coat the pan evenly. Scatter half the bean sprouts over top.

  5. 5

    Cook until edges turn golden and crispy (edges should look lacy), about 3–4 minutes. Do not flip.

  6. 6

    Fold crepe in half and slide onto a plate. Repeat with remaining butter, seafood, batter, and sprouts. Serve with lettuce, herbs, and dipping sauce.

Tools you’ll need

  • 10-inch nonstick skillet
  • whisk
  • small bowl (for dipping sauce)
  • rubber spatula or wooden spoon
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.