CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Shao Bing & Youtiao

Flaky puff pastry folded with scallions and sesame, topped with a gooey egg and crispy fried dough sticks. A Taiwanese breakfast-for-dinner that tastes like a street stall in your skillet.

Total time
20 min
Servings
2
Calories
520
Protein
12g
Crispy Shao Bing & Youtiao
casualsatisfyingtaiwaneseeggscrispyflakytenderweeknight

Ingredients

  • 1 sheet, thawed frozen puff pastry sheets
  • 2 stalks scallions, chopped
  • 1 tbsp sesame seeds (white or black)
  • ¼ cup fried shallots or crispy onions
  • 2 large eggs
  • 1 tbsp soy sauce
  • 2 pieces store-bought youtiao (fried dough stick), halved lengthwise

Instructions

  1. 1

    Unfold puff pastry on a cutting board and brush lightly with water. Sprinkle scallions, sesame seeds, and half the fried shallots across the surface.

  2. 2

    Roll pastry tightly into a log, then curl it into a spiral. Flatten gently with your palm until about 1/2-inch thick.

  3. 3

    Heat 2 tbsp oil in a 12-inch skillet over medium-high until shimmering. Slide the spiral into the pan and sear 3–4 minutes per side until golden brown and crispy.

  4. 4

    Push pastry to the side of the skillet. Crack eggs into the empty space and cook until whites set but yolks still jiggle, about 2 minutes.

  5. 5

    Lay halved youtiao pieces on top of the pastry. Drizzle soy sauce over everything and scatter remaining fried shallots.

  6. 6

    Serve hot straight from the skillet. Tear pieces and dip in extra soy sauce if desired.

Tools you’ll need

  • cutting board
  • 12-inch skillet
  • silicone spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.