CookSnap is coming soon — Join the waitlist →

Crispy Shao Bing Egg Wrap

Flaky scallion pancakes stuffed with scrambled eggs and crispy fried dough, then pan-seared until golden. A Taiwanese breakfast-for-dinner that comes together in 15 minutes.

Total time
15 min
Servings
2
Calories
480
Protein
14g
Crispy Shao Bing Egg Wrap
comfortcasualtaiwaneseeggscrispyflakytenderweeknight

Ingredients

  • 2 pieces frozen shao bing (scallion pancake)
  • 1 piece you tiao (fried dough stick), store-bought
  • 3 whole eggs
  • 2 stalks scallions, chopped
  • 1 tbsp soy sauce
  • ½ tsp sesame oil
  • 2 tbsp neutral cooking oil

Instructions

  1. 1

    Heat 1 tbsp oil in a skillet over medium-high. Whisk eggs with soy sauce and sesame oil, then pour into the pan.

  2. 2

    Scramble eggs gently until just set, about 2 minutes. Stir in half the scallions, then transfer to a plate.

  3. 3

    Chop the you tiao into bite-sized pieces. Unfold each shao bing gently and layer in half the eggs and you tiao pieces.

  4. 4

    Fold the shao bing over the filling to form a wrap. Repeat with the second pancake and remaining fillings.

  5. 5

    Add 1 tbsp oil to the skillet over medium. Sear each wrap 2 minutes per side until edges are golden and crispy.

  6. 6

    Slice each wrap in half, top with remaining scallions, and serve hot.

Tools you’ll need

  • 12-inch nonstick or cast iron skillet
  • bowl for whisking
  • spatula
  • cutting board and knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.