CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Sambusa with Cabbage & Chili

Golden fried pastry triangles filled with spiced beef, served alongside cool shredded cabbage and fresh chili peppers. Ready in 20 minutes with store-bought phyllo or wonton wrappers.

Total time
20 min
Servings
2
Calories
520
Protein
24g
Crispy Sambusa with Cabbage & Chili
casualindulgentethiopianbeefcrispytenderweeknightdinner

Ingredients

  • ½ lb ground beef
  • 12 sheets phyllo or wonton wrappers
  • ¼ medium yellow onion, minced
  • 2 whole fresh chili peppers (serrano or jalapeño), minced
  • 2 cups shredded green cabbage
  • 3 tbsp neutral cooking oil

Instructions

  1. 1

    Brown ground beef in a skillet over medium-high with minced onion and half the chili, breaking up meat, ~5 minutes. Season with salt and pepper, then cool slightly.

  2. 2

    Lay one wrapper flat. Place 1 tbsp beef filling in the lower-left corner and fold into a triangle, sealing edges with a dab of water.

  3. 3

    Heat 2 tbsp oil in a large skillet over medium-high. Pan-fry triangles in batches, ~90 seconds per side, until golden and crispy.

  4. 4

    Toss cabbage with remaining minced chili and a pinch of salt. Serve sambusas hot with the cabbage slaw on the side.

Tools you’ll need

  • 12-inch skillet
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.