Custrd is out on the App Store — Download it free →
Back to recipes

20-Min Crispy Beef Pastel

Paper-thin pastry pockets filled with spiced ground beef, pan-fried until golden and shattering. Brazilian street-food energy in 20 minutes.

Total time
20 min
Servings
4
Calories
385
Protein
18g
20-Min Crispy Beef Pastel
casualindulgentbrazilianbeefcrispytenderweeknightgame-day

Ingredients

  • ¾ lb ground beef
  • ½ medium yellow onion, diced
  • ⅓ cup green olives, sliced
  • ½ tsp cumin
  • 1 tbsp hot sauce or piri-piri
  • 16 count empanada or gyoza wrappers (frozen, thawed)
  • 2 tbsp neutral cooking oil

Instructions

  1. 1

    Brown ground beef over medium-high heat, breaking it up with a spoon, until no pink remains, ~5 minutes.

  2. 2

    Add diced onion and cook, stirring, for 2 minutes until softened and fragrant.

  3. 3

    Stir in cumin, hot sauce, and olives. Remove from heat and cool for 1 minute.

  4. 4

    Spoon 1 tbsp filling onto the center of each wrapper. Fold in half and seal edges by pressing with a wet fork.

  5. 5

    Heat oil in a large skillet over medium-high until it shimmers, ~90 seconds. Working in batches, fry pastels until deep golden brown, ~90 seconds per side.

  6. 6

    Transfer to a plate lined with paper towels. Serve hot with lime wedges if desired.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon
  • fork for sealing

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.