CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Rice Paper Rolls with Peanut Sauce

Vietnamese-style vegetable rolls wrapped in crispy rice paper, served with a warm peanut dipping sauce. Ready in 15 minutes with zero cooking required.

Total time
15 min
Servings
2
Calories
285
Protein
10g
Crispy Rice Paper Rolls with Peanut Sauce
freshlightvietnamesevegetarianveganvegetariancrispytender

Ingredients

  • 8 sheets rice paper wrappers
  • 1 head butter lettuce or romaine leaves
  • 1 medium cucumber
  • 1 cup, loosely packed fresh herbs (mint, basil, cilantro)
  • ¼ cup natural peanut butter
  • 2 tbsp rice vinegar

Instructions

  1. 1

    Slice cucumber lengthwise into 1/4-inch-thick batons. Tear lettuce into bite-size pieces. Tear herbs roughly.

  2. 2

    Whisk peanut butter with rice vinegar and 3 tbsp warm water until smooth and pourable. Add a pinch of salt.

  3. 3

    Dip one rice paper into room-temperature water for 5 seconds until pliable. Lay flat on a cutting board.

  4. 4

    Layer lettuce, cucumber batons, and herbs in a tight row near the bottom. Fold the sides in, then roll tightly.

  5. 5

    Repeat with remaining rice papers. Cut rolls in half on an angle if desired.

  6. 6

    Serve rolls with warm peanut sauce for dipping.

Tools you’ll need

  • cutting board
  • sharp knife
  • shallow dish or wide bowl for water
  • small bowl for sauce
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Vietnamese recipes →