CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Potato Farl With Butter & Scallions

Pan-fried Irish potato farls: mashed potatoes mixed into a quick dough, cut into wedges, and crisped until golden. Serve hot with melting butter and sharp cheddar for a complete weeknight meal.

Total time
25 min
Servings
2
Calories
385
Protein
9g
Crispy Potato Farl With Butter & Scallions
comfortcozyirishvegetarianvegetariancrispytenderweeknight

Ingredients

  • 1 lb russet potatoes, peeled
  • ¾ cup all-purpose flour
  • 4 tbsp (divided) butter
  • ½ cup sharp cheddar, shredded
  • 2 tbsp scallions, chopped
  • 1 to taste salt and pepper

Instructions

  1. 1

    Chop potatoes into 1-inch cubes, boil in salted water until fork-tender, about 12 minutes. Drain well.

  2. 2

    Mash potatoes until smooth. Stir in flour, 2 tbsp butter, cheese, and scallions. Season with salt and pepper.

  3. 3

    Divide dough in half. Pat each half into a 6-inch disk on parchment, then cut each into 4 wedges.

  4. 4

    Heat 1 tbsp butter in a large skillet over medium-high until foaming. Fry farls in two batches, 3–4 minutes per side until golden and crispy.

  5. 5

    Transfer to a plate, top with remaining 1 tbsp butter. Serve hot with extra cheese or sour cream if desired.

Tools you’ll need

  • chef's knife
  • cutting board
  • pot (3-quart)
  • colander
  • mixing bowl
  • wooden spoon
  • parchment paper
  • 12-inch skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.