Custrd is out on the App Store — Download it free →
Back to recipes

Crispy Potato & Cheese Krokiety

Polish potato-and-cheese rolls, fried until golden and crunchy. A nostalgic vegetarian comfort dish that tastes like street food but comes together in 20 minutes.

Total time
20 min
Servings
4
Calories
485
Protein
12g
Crispy Potato & Cheese Krokiety
comfortnostalgicpolishvegetariancheesecrispycreamyweeknight

Ingredients

  • 1 lb russet potatoes
  • 1 cup sharp cheddar cheese, shredded
  • ¾ cup all-purpose flour, divided
  • 1 large egg
  • ½ cup panko breadcrumbs
  • 2 cups neutral oil for frying

Instructions

  1. 1

    Peel potatoes, cut into chunks, and boil in salted water until fork-tender, ~10 minutes. Drain and mash with salt and pepper until smooth.

  2. 2

    Fold shredded cheese into warm mashed potatoes. Cool for 2 minutes until handleable.

  3. 3

    Set up three shallow bowls: flour in one, beaten egg in the second, panko in the third. Shape potato mixture into 8 logs, each 3 inches long.

  4. 4

    Coat each log in flour, then egg, then panko, pressing gently so crumbs stick. Place on a plate.

  5. 5

    Heat oil in a large skillet over medium-high until a breadcrumb sizzles immediately when dropped in. Fry logs 2–3 minutes per side until deep golden brown.

  6. 6

    Transfer to a paper-towel-lined plate. Serve hot with sour cream or mustard for dipping.

Tools you’ll need

  • large pot
  • colander
  • potato masher
  • three shallow bowls
  • large skillet
  • instant-read or candy thermometer (optional)
  • slotted spoon or spider strainer
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.