CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Potato Krokiety with Sour Cream

Polish fried crepe rolls stuffed with seasoned mashed potato—golden, crispy outside, creamy inside. Serve with a dollop of sour cream for the classic combination.

Total time
20 min
Servings
2
Calories
520
Protein
12g
Crispy Potato Krokiety with Sour Cream
comfortcasualpolishvegetarianvegetariancrispycreamyweeknight

Ingredients

  • 12 oz russet potatoes, peeled and diced small
  • ¾ cup all-purpose flour
  • ½ cup whole milk
  • 2 whole eggs
  • ½ cup sour cream
  • 1 cup neutral oil for frying

Instructions

  1. 1

    Boil potatoes in salted water until fork-tender, about 8 minutes. Drain well and return to pot.

  2. 2

    Mash potatoes with butter and a pinch of salt and pepper until smooth. Set aside to cool slightly.

  3. 3

    Whisk flour, milk, eggs, and a pinch of salt into a thin batter—like crêpe batter, no lumps.

  4. 4

    Heat 1 tbsp oil in a 10-inch skillet over medium-high. Pour 2 tbsp batter, tilt to coat thinly, cook until light gold, ~60 seconds per side. Stack finished crêpes.

  5. 5

    Spread 1 tbsp warm mashed potato on the center third of each crêpe. Fold in sides, then roll tightly into a cylinder.

  6. 6

    Heat remaining oil in the same skillet to 350°F. Fry krokiety in batches, seam-side down first, until deep golden, ~90 seconds per side. Drain on paper towels.

  7. 7

    Serve hot with a dollop of sour cream on the side.

Tools you’ll need

  • medium pot
  • 10-inch nonstick skillet
  • whisk
  • spatula
  • paper towels
  • instant-read thermometer (optional)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.