Crispy Pita Pizzas
Pita bread topped with pizza sauce, melted mozzarella, and spinach, then baked until the cheese bubbles. Ready in 12 minutes — the weeknight pizza that actually happens.
- Total time
- 12 min
- Servings
- 2
- Calories
- 320
- Protein
- 14g
quickcasualitalianvegetariancrispymeltyweeknightpizza
Ingredients
- 2 rounds pita bread
- ½ cup pizza sauce
- 2 cups, loosely packed fresh spinach
- 1 cup mozzarella cheese, shredded
Instructions
- 1
Preheat oven to 400°F.
- 2
Spread 2 pita rounds on a sheet pan, then divide pizza sauce evenly between them.
- 3
Layer spinach onto each pita, dividing evenly, then top with shredded mozzarella.
- 4
Bake until cheese melts and edges bubble, about 8 minutes.
- 5
Serve hot.
Tools you’ll need
- sheet pan
- oven
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
