Crispy Mozzarella Margherita Flatbread
Flatbread topped with warm marinara, melted fresh mozzarella, and basil. Toast it until the crust crisps and the cheese bubbles, then finish with a basil shower for a 10-minute dinner.
- Total time
- 10 min
- Servings
- 2
- Calories
- 320
- Protein
- 12g
simplecasualitalianvegetariancrispymeltyweeknightflatbread
Ingredients
- 1 piece flatbread
- ½ cup marinara sauce
- ½ cup (torn) fresh mozzarella
- 6 leaves fresh basil
Instructions
- 1
Heat a skillet over medium-high heat until oil shimmers, about 1 minute.
- 2
Place flatbread in the skillet and toast 1 minute until the bottom starts to brown.
- 3
Spread marinara sauce over the flatbread and top with torn fresh mozzarella.
- 4
Cover the skillet and cook 2-3 minutes until cheese melts and edges crisp.
- 5
Tear basil leaves over the top and serve hot.
Tools you’ll need
- 12-inch skillet or larger
- spatula
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
