CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Mozzarella Margherita Flatbread

Flatbread topped with warm marinara, melted fresh mozzarella, and basil. Toast it until the crust crisps and the cheese bubbles, then finish with a basil shower for a 10-minute dinner.

Total time
10 min
Servings
2
Calories
320
Protein
12g
Crispy Mozzarella Margherita Flatbread
simplecasualitalianvegetariancrispymeltyweeknightflatbread

Ingredients

  • 1 piece flatbread
  • ½ cup marinara sauce
  • ½ cup (torn) fresh mozzarella
  • 6 leaves fresh basil

Instructions

  1. 1

    Heat a skillet over medium-high heat until oil shimmers, about 1 minute.

  2. 2

    Place flatbread in the skillet and toast 1 minute until the bottom starts to brown.

  3. 3

    Spread marinara sauce over the flatbread and top with torn fresh mozzarella.

  4. 4

    Cover the skillet and cook 2-3 minutes until cheese melts and edges crisp.

  5. 5

    Tear basil leaves over the top and serve hot.

Tools you’ll need

  • 12-inch skillet or larger
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.