Custrd is out on the App Store — Download it free →
Back to recipes

Crispy Missi Roti with Chili Oil

Chickpea flour flatbread studded with caramelized onions and spices, pan-fried until golden and crispy. Serve with chili oil for dipping and a squeeze of lemon—ready in under 25 minutes.

Total time
25 min
Servings
2
Calories
240
Protein
8g
Crispy Missi Roti with Chili Oil
comfortsatisfyingindianvegetarianveganchickpeascrispysoft

Ingredients

  • 1 cup chickpea flour (besan)
  • ½ medium yellow onion, thinly sliced
  • 1 whole green chili, minced (or 0.5 tsp red chili flakes)
  • ½ tsp carom seeds (ajwain)
  • ¼ tsp turmeric powder
  • 2 tbsp chili oil or neutral oil with chili flakes
  • ½ cup warm water

Instructions

  1. 1

    Heat 1 tbsp oil in a skillet over medium-high. Add sliced onions, cook 5-6 minutes, stirring, until deeply golden and fragrant.

  2. 2

    Mix chickpea flour, turmeric, carom seeds, green chili, salt, and pepper in a bowl. Add golden onions and stir to combine.

  3. 3

    Pour warm water slowly into the flour mixture, stirring until you have a thick, sticky dough that comes together.

  4. 4

    Heat remaining 1 tbsp chili oil in the skillet over medium-high until it shimmers, about 90 seconds.

  5. 5

    Drop a large spoonful of dough onto the hot skillet. Use the back of the spoon to flatten into a rough 4-inch round, about 0.25-inch thick.

  6. 6

    Cook 2-3 minutes per side until edges curl, surface blisters, and color turns golden-brown. Flip once. Repeat with remaining dough.

Tools you’ll need

  • 12-inch skillet or cast-iron pan
  • medium mixing bowl
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.