Custrd is out on the App Store — Download it free →
Back to recipes

Crispy Malakoff: Cheese & Ham Stack

A Swiss classic reimagined as a golden, melty-cheese-and-ham stack that crisps in one skillet. Tender inside, crunchy outside, ready in 15 minutes.

Total time
15 min
Servings
2
Calories
428
Protein
18g
Crispy Malakoff: Cheese & Ham Stack
comfortindulgentswissvegetariancheesecrispymeltycreamy

Ingredients

  • 6 slices Emmental cheese, sliced 1/4-inch thick
  • ½ cup all-purpose flour
  • 1 large egg, beaten
  • ¾ cup panko breadcrumbs
  • 2 tbsp butter
  • 1 tbsp dijon mustard

Instructions

  1. 1

    Arrange 3 cheese slices overlapping on a board; spread with half the mustard, then top with 3 more cheese slices.

  2. 2

    Place flour in one shallow bowl, beaten egg in another, breadcrumbs in a third.

  3. 3

    Dredge the cheese stack in flour, shaking off excess; dip in egg until coated, then press into breadcrumbs on both sides.

  4. 4

    Heat butter in a skillet over medium-high until foaming, about 90 seconds.

  5. 5

    Slide the breaded stack into the skillet; fry until golden and cheese begins peeking through edges, 2 to 3 minutes per side.

  6. 6

    Transfer to a plate, let rest 1 minute, slice in half, and serve immediately with a small salad or cornichons.

Tools you’ll need

  • cutting board
  • 12-inch nonstick or cast iron skillet
  • three shallow bowls
  • tongs or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.