Custrd is out on the App Store — Download it free →
Back to recipes

Melty Cheese & Potato Skillet

Chäschüechli is Swiss comfort food—crispy potato cakes melted with cheese and onion. This weeknight version skips the pastry and delivers the same gooey, golden magic in one skillet.

Total time
25 min
Servings
2
Calories
520
Protein
22g
Melty Cheese & Potato Skillet
comfortcozyswissvegetariancheesecrispycreamymelty

Ingredients

  • 1.5 lbs potatoes, waxy (e.g. Yukon gold)
  • 1.5 cups gruyère or emmental cheese, shredded
  • 1 medium yellow onion
  • 3 tbsp all-purpose flour
  • 2 tbsp butter
  • 1 pinch salt and black pepper to taste

Instructions

  1. 1

    Peel potatoes, grate them on the large holes of a box grater, then squeeze out excess moisture in a clean kitchen towel.

  2. 2

    Dice onion fine. Toss grated potato with cheese, onion, flour, salt, and pepper until evenly coated.

  3. 3

    Heat butter in a 10-inch nonstick skillet over medium-high until foaming, about 90 seconds.

  4. 4

    Press potato mixture into the pan, spreading it flat to the edges. Cook without stirring until bottom is golden and crisp, 6–8 minutes.

  5. 5

    Slide cake onto a plate, flip it back into the pan raw-side down, and cook until second side is golden and cheese melts through, 5–6 minutes.

  6. 6

    Slide onto a cutting board, slice into wedges, and serve hot with a sharp pickled onion or fresh green salad on the side.

Tools you’ll need

  • box grater
  • kitchen towel
  • 10-inch nonstick skillet
  • rubber spatula or offset spatula
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.