CookSnap is coming soon — Join the waitlist →
Back to recipes

Swiss Älplermagronen (Mountain Mac)

Creamy potato and pasta bake with melted cheese and crispy onions—a Swiss mountain comfort classic ready in 25 minutes. One skillet, zero fuss.

Total time
25 min
Servings
4
Calories
620
Protein
24g
Swiss Älplermagronen (Mountain Mac)
comfortcozyswissalpinevegetariancheesecreamytender

Ingredients

  • 1 lb waxy potatoes (Yukon Gold or similar)
  • 8 oz short pasta (elbow or penne)
  • 1.5 cups Gruyère cheese, shredded
  • 1 cup Appenzell or Emmental cheese, shredded
  • 1 medium yellow onion, thinly sliced
  • ½ cup heavy cream
  • 2 tbsp fresh chives or parsley, chopped

Instructions

  1. 1

    Cut potatoes into 0.5-inch cubes. Boil in salted water 8 minutes until just tender.

  2. 2

    Boil pasta in salted water until al dente, about 10 minutes. Drain and set aside.

  3. 3

    Heat 2 tbsp butter in a large skillet over medium-high. Sauté onion slices 5 minutes until golden and crispy at edges.

  4. 4

    Add cooked potatoes and pasta to the skillet. Stir in both cheeses, cream, salt, and pepper until melted and creamy.

  5. 5

    Cook 2 minutes, stirring gently, until the mixture is hot and cohesive—it should be creamy, not dry.

  6. 6

    Divide into bowls. Top with chives. Serve immediately while the cheese is molten.

Tools you’ll need

  • large pot (for boiling potatoes)
  • large pot (for boiling pasta)
  • large skillet, 12-inch minimum
  • wooden spoon
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.