Crispy Lime Shrimp Tostadas
Golden tostadas topped with bright ceviche-style shrimp, creamy avocado, and a zesty lime punch. Ready in under 15 minutes — crispy, tangy, and totally craveable.
- Total time
- 12 min
- Servings
- 2
- Calories
- 285
- Protein
- 18g

freshlightcalifornianshrimpcrispycreamyweeknightappetizer
Ingredients
- 4 whole corn tortillas
- ½ lb cooked shrimp, chopped
- 1 whole avocado, ripe
- 2 whole limes
- ¼ cup red onion, finely diced
- 3 tbsp cilantro, chopped
- 2 tbsp neutral cooking oil
Instructions
- 1
Heat oil in a skillet over medium-high until it shimmers. Fry each tortilla 60–90 seconds per side until golden and crispy.
- 2
While tortillas cool, toss shrimp with diced red onion, cilantro, juice of 1 lime, salt, and pepper.
- 3
Halve and pit the avocado, then slice each half into thin wedges.
- 4
Top each crispy tortilla with avocado slices, then pile the shrimp mixture on top.
- 5
Squeeze the remaining lime over everything. Serve immediately.
Tools you’ll need
- 12-inch skillet
- tongs or fork
- small bowl
- knife and cutting board
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



