CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Lime Shrimp Tostadas

Golden tostadas topped with bright ceviche-style shrimp, creamy avocado, and a zesty lime punch. Ready in under 15 minutes — crispy, tangy, and totally craveable.

Total time
12 min
Servings
2
Calories
285
Protein
18g
Crispy Lime Shrimp Tostadas
freshlightcalifornianshrimpcrispycreamyweeknightappetizer

Ingredients

  • 4 whole corn tortillas
  • ½ lb cooked shrimp, chopped
  • 1 whole avocado, ripe
  • 2 whole limes
  • ¼ cup red onion, finely diced
  • 3 tbsp cilantro, chopped
  • 2 tbsp neutral cooking oil

Instructions

  1. 1

    Heat oil in a skillet over medium-high until it shimmers. Fry each tortilla 60–90 seconds per side until golden and crispy.

  2. 2

    While tortillas cool, toss shrimp with diced red onion, cilantro, juice of 1 lime, salt, and pepper.

  3. 3

    Halve and pit the avocado, then slice each half into thin wedges.

  4. 4

    Top each crispy tortilla with avocado slices, then pile the shrimp mixture on top.

  5. 5

    Squeeze the remaining lime over everything. Serve immediately.

Tools you’ll need

  • 12-inch skillet
  • tongs or fork
  • small bowl
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.