CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Hilopites with Butter & Herbs

Tender hand-torn egg pasta crisped in browned butter with fresh herbs—pure Greek comfort in 25 minutes. No sauce, no fuss, just golden, nutty, and totally addictive.

Total time
25 min
Servings
2
Calories
420
Protein
10g
Crispy Hilopites with Butter & Herbs
simplecomfortgreekvegetarianvegetariancrispytenderweeknight

Ingredients

  • 1.5 cups all-purpose flour
  • 2 large eggs
  • 4 tbsp butter
  • 1 tbsp fresh lemon juice
  • 2 tbsp, chopped fresh dill or parsley
  • ½ tsp, plus more for pasta water kosher salt

Instructions

  1. 1

    Mix flour and salt in a bowl. Make a well, crack eggs into it, then stir with a fork until shaggy dough forms.

  2. 2

    Knead dough on a clean counter until smooth and elastic, about 3 minutes. Rest it covered while you bring a pot of salted water to a boil.

  3. 3

    Break dough into small, irregular pieces roughly the size of a pea. Drop into boiling water and cook until they float, then 2 more minutes.

  4. 4

    Drain pasta well. Heat butter in a large skillet over medium-high until edges turn golden brown and smell nutty, about 2 minutes.

  5. 5

    Add drained pasta to hot butter and toss constantly until edges crisp and turn pale gold, 3–4 minutes. The pan should sound loud and sizzly.

  6. 6

    Remove from heat. Pour lemon juice over top, add fresh dill, toss once. Taste and adjust salt. Serve immediately.

Tools you’ll need

  • large mixing bowl
  • fork
  • pot for boiling
  • large skillet, 10-inch minimum
  • wooden spoon or tongs
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.