CookSnap is coming soon — Join the waitlist →

Tortelli di Zucca — Butternut Pasta with Sage

Buttery roasted butternut ravioli with crispy sage and Parmigiano — restaurant-worthy in 25 minutes using wonton wrappers as a shortcut. Golden, nutty, one-pan finish.

Total time
25 min
Servings
2
Calories
485
Protein
18g
Tortelli di Zucca — Butternut Pasta with Sage
elegantsimpleitalianvegetarianvegetariantendercrispysilky

Ingredients

  • 1 cup butternut squash, roasted or pre-cooked
  • ½ cup Parmigiano-Reggiano, grated
  • 24 wrappers wonton wrappers or round gyoza skins
  • 4 tbsp butter
  • 12 leaves fresh sage leaves
  • 1 pinch salt
  • 1 pinch black pepper
  • ⅛ tsp nutmeg, freshly grated

Instructions

  1. 1

    Mix roasted butternut squash, 1/4 cup Parmigiano, salt, pepper, and nutmeg in a bowl until combined.

  2. 2

    Place 1 teaspoon filling in center of each wonton wrapper, wet edges with water, fold into half-moon, then press corners together.

  3. 3

    Bring a large pot of salted water to a boil; cook tortelli in batches until they float and then 2 minutes more, ~4 minutes total.

  4. 4

    While tortelli cook, melt butter in a large skillet over medium heat; add sage leaves and cook until edges curl and butter foams, ~3 minutes.

  5. 5

    Lift cooked tortelli from water with a slotted spoon and transfer directly into the sage butter; gently toss to coat.

  6. 6

    Divide onto plates, scatter remaining Parmigiano over top, and serve immediately while butter still sizzles.

Tools you’ll need

  • large mixing bowl
  • large pot
  • large skillet (12-inch)
  • slotted spoon
  • microplane or fine grater

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.