CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Spätzle with Brown Butter & Sage

Tender egg noodles fried until golden and tossed in nutty brown butter with crispy sage—a German comfort dish that feels fancy but comes together in 20 minutes.

Total time
20 min
Servings
2
Calories
520
Protein
18g
Crispy Spätzle with Brown Butter & Sage
comfortcozygermanvegetarianeggscrispytenderweeknight

Ingredients

  • 1.5 cups all-purpose flour
  • 3 whole eggs
  • ½ cup whole milk
  • 4 tbsp butter
  • 8 leaves fresh sage leaves
  • ½ cup gruyère cheese, grated

Instructions

  1. 1

    Whisk flour, eggs, milk, and a big pinch of salt until smooth, like thick pancake batter.

  2. 2

    Bring a large pot of salted water to a boil. Working in batches, push batter through a colander into the water.

  3. 3

    Spätzle will sink, then float to the surface after 2–3 minutes. Scoop them out with a slotted spoon onto a plate.

  4. 4

    Heat butter in a large skillet over medium-high until foaming and golden, about 2 minutes.

  5. 5

    Add sage leaves and cook 30 seconds until fragrant, then add spätzle and toss until edges turn crispy and golden, 3–4 minutes.

  6. 6

    Toss with gruyère, salt, and pepper. Serve immediately while the butter foams.

Tools you’ll need

  • large pot
  • colander with small holes
  • slotted spoon
  • large skillet (12-inch)
  • whisk
  • bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.