CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Halloumi Popcorn with Fries & Dip

Cubed halloumi cheese fried until golden and squeaky, tossed hot with salt and served alongside crispy fries and your favorite dipping sauce. Pure indulgence in under 10 minutes.

Total time
10 min
Servings
2
Calories
380
Protein
20g
Crispy Halloumi Popcorn with Fries & Dip
indulgentcasualmediterraneanvegetariancheesecrispysqueakymelty

Ingredients

  • 8 oz halloumi cheese
  • 1 bag (about 10 oz) frozen fries (store-bought)
  • ½ cup dipping sauce (marinara, tzatziki, or sriracha mayo)

Instructions

  1. 1

    Cut halloumi into 1/2-inch cubes and pat dry with paper towels.

  2. 2

    Cook frozen fries per package directions (oven or air fryer) until golden and hot.

  3. 3

    Heat oil in a skillet over medium-high until shimmering, about 1 minute.

  4. 4

    Add halloumi cubes in a single layer and cook without stirring for 90 seconds until golden.

  5. 5

    Toss halloumi and cook another 60-90 seconds until all sides are golden and cheese squeaks slightly.

  6. 6

    Transfer halloumi to a plate, season with salt and pepper, and serve immediately with hot fries and dipping sauce.

Tools you’ll need

  • 12-inch skillet
  • cutting board
  • knife
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.