CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Halloumi Fries with Tzatziki

Golden, squeaky-hot cheese fries fried until the outside crackles and the inside stays creamy. Serve with cool, garlicky yogurt sauce for the perfect Mediterranean snack or side.

Total time
15 min
Servings
2
Calories
420
Protein
22g
Crispy Halloumi Fries with Tzatziki
casualindulgentmediterraneanvegetariangluten-freevegetariancrispycreamy

Ingredients

  • ¾ lb halloumi cheese, block
  • 3 tablespoons olive oil
  • ½ cup Greek yogurt
  • 1 clove garlic, clove
  • ½ lemon lemon
  • ¼ teaspoon each salt and pepper

Instructions

  1. 1

    Remove the halloumi block from the packaging and pat it completely dry with paper towels on both sides, pressing gently to absorb all moisture so it will fry crispy.

  2. 2

    Place the halloumi on a cutting board and slice it lengthwise into eight strips, each about 0.5 inches wide and 0.25 inches thick, like french fry shapes.

  3. 3

    Mince the garlic clove until the pieces are smaller than a grain of rice, about the size of pencil-tip dots.

  4. 4

    Stir the minced garlic into the Greek yogurt in a small bowl, then squeeze in the juice from the half lemon and stir until combined, creating your tzatziki sauce.

  5. 5

    Pour 3 tablespoons of olive oil into a 12-inch skillet and heat over medium-high heat until it shimmers and slides quickly when you tilt the pan, about 90 seconds.

  6. 6

    Carefully place half the halloumi strips into the hot oil, leaving a small space between each one so they cook evenly, not touching.

  7. 7

    Cook the first batch without moving them for 2 minutes, watching until the bottom turns golden honey-brown and begins to look crispy at the edges.

  8. 8

    Flip each halloumi strip with a thin spatula and cook the second side for another 90 seconds until it also turns golden brown and the cheese no longer sticks to the pan.

  9. 9

    Transfer the cooked halloumi fries to a paper towel-lined plate and let them rest for 1 minute so excess oil drains off and the exterior stays crispy.

  10. 10

    Repeat steps 6–9 with the remaining halloumi strips using the same skillet with the oil remaining in the pan.

  11. 11

    Arrange all halloumi fries on a serving plate, sprinkle with a pinch of salt and pepper, and serve immediately with the tzatziki sauce in a small bowl on the side for dipping.

Tools you’ll need

  • paper towels
  • cutting board
  • knife
  • small bowl
  • spoon
  • 12-inch skillet
  • thin spatula
  • small plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.