CookSnap is coming soon — Join the waitlist →

Crispy Halloumi Fries with Lemon

Golden, squeaky halloumi cheese fried until the outside is crispy and the inside stays firm. Serve with a squeeze of fresh lemon for a Mediterranean appetizer that takes just 15 minutes.

Total time
15 min
Servings
2
Calories
320
Protein
22g
Crispy Halloumi Fries with Lemon
casualsimplemediterraneanvegetariancheesecrispysqueakyappetizer

Ingredients

  • 8 oz halloumi cheese
  • 2 tablespoons olive oil
  • ½ whole lemon
  • ¼ teaspoon salt
  • ⅛ teaspoon pepper

Instructions

  1. 1

    Remove the halloumi from the refrigerator and pat it dry on both sides using paper towels, blotting away all moisture until the surface feels dry to the touch.

  2. 2

    Cut the halloumi crosswise into rectangles about 1/3 inch thick and 2 inches long, like sticks of butter standing on end.

  3. 3

    Place a large skillet on the stovetop and turn the heat to medium-high until it feels hot when you hold your hand 2 inches above the surface, about 2 minutes.

  4. 4

    Pour 2 tablespoons of olive oil into the hot skillet and wait until the oil shimmers and slides quickly when you tilt the pan, about 60 seconds.

  5. 5

    Carefully place the halloumi sticks into the oil in a single layer, leaving a tiny gap between each piece so they do not touch.

  6. 6

    Cook the halloumi without moving for 2 minutes until the bottom turns the color of warm honey and looks slightly crispy.

  7. 7

    Using tongs or a fork, flip each stick over and cook for another 2 minutes until the second side is golden brown and crispy like the first.

  8. 8

    Transfer the halloumi fries to a serving plate using tongs, arranging them in a single layer so they stay warm and crispy.

  9. 9

    Sprinkle 1/4 teaspoon of salt and 1/8 teaspoon of pepper evenly over all the fries.

  10. 10

    Cut the lemon half into two wedges and place them next to the halloumi fries so each person can squeeze fresh lemon juice over their portion.

Tools you’ll need

  • paper towels
  • cutting board
  • chef's knife
  • large skillet (10–12 inch)
  • tongs or fork
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.