CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Green Fava Ta'ameya

Egyptian street-food magic: bright green fava bean fritters, fried until golden-crispy outside, fluffy within. Takes 15 minutes total and needs just one skillet.

Total time
15 min
Servings
2
Calories
285
Protein
12g
Crispy Green Fava Ta'ameya
casualsatisfyingegyptianvegetarianveganchickpeascrispyfluffy

Ingredients

  • 2 cups frozen shelled fava beans (or canned, drained)
  • ¾ cup fresh parsley (loosely packed)
  • ¼ medium yellow onion
  • 3 tbsp all-purpose flour
  • ½ tsp cumin
  • ½ cup neutral cooking oil (for frying)

Instructions

  1. 1

    Pulse fava beans, parsley, onion, flour, cumin, 0.5 tsp salt, and 0.25 tsp pepper in a food processor until coarse crumbles form—do not puree.

  2. 2

    Scoop into 8 balls, then flatten each into a 2-inch patty. Rest on a plate while oil heats.

  3. 3

    Heat oil in a skillet over medium-high until a small piece of mixture sizzles immediately when dropped in, ~2 minutes.

  4. 4

    Fry patties 2 minutes per side without moving until golden brown and crispy on both edges.

  5. 5

    Transfer to paper towels to drain. Season with a pinch of salt.

  6. 6

    Serve hot, preferably in a pita or with tahini sauce for dipping.

Tools you’ll need

  • food processor
  • 10-inch skillet
  • cooking thermometer (optional)
  • slotted spoon or spider strainer
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.