CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Falafel & Hummus Bowl

Golden, crispy falafel served over creamy hummus with fresh herbs and a drizzle of olive oil. Crunchy outside, fluffy inside—ready in under 25 minutes with canned chickpeas.

Total time
25 min
Servings
2
Calories
520
Protein
16g
Crispy Falafel & Hummus Bowl
satisfyingcasualmiddle-easternvegetarianveganchickpeascrispycreamy

Ingredients

  • 1 can (15 oz) canned chickpeas, drained and patted dry
  • ⅓ cup all-purpose flour
  • 1 tsp cumin
  • ¼ cup tahini
  • 2 tbsp lemon juice
  • 2 cloves garlic, minced
  • ¼ cup fresh parsley (or cilantro), chopped

Instructions

  1. 1

    Pulse chickpeas with flour, cumin, 1 clove garlic, salt, and pepper until mixture holds together but is still crumbly, ~90 seconds.

  2. 2

    Heat 1 inch of neutral oil in a heavy skillet over medium-high until it shimmers, ~3 minutes.

  3. 3

    Scoop 1-tbsp portions of falafel mixture and flatten into small patties. Fry in batches without crowding, 2 minutes per side until deep golden.

  4. 4

    Whisk tahini with lemon juice, 1 clove minced garlic, salt, pepper, and 2 tbsp water until creamy. Spread on a plate or shallow bowl.

  5. 5

    Arrange warm falafel over hummus. Drizzle with olive oil and scatter parsley on top.

  6. 6

    Serve immediately with lemon wedges on the side.

Tools you’ll need

  • food processor
  • heavy skillet (10-12 inch)
  • instant-read thermometer (optional, oil should reach ~350°F)
  • slotted spoon
  • whisk
  • shallow bowl or plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.