CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Ghee Dosa with Chili Oil

Paper-thin, golden dosa brushed with ghee and finished with chili oil and crispy onions. Ready in 15 minutes using a premade dosa batter shortcut.

Total time
15 min
Servings
2
Calories
420
Protein
6g
Crispy Ghee Dosa with Chili Oil
comfortcasualindianvegetarianvegetariancrispytenderweeknight

Ingredients

  • 1.5 cups store-bought dosa batter (frozen or fresh)
  • 3 tbsp ghee
  • ½ tsp red chili flakes
  • 1 small yellow onion, sliced thin
  • ½ cup coconut chutney (store-bought or fresh)
  • 1 tbsp sambar powder

Instructions

  1. 1

    Heat a non-stick skillet or griddle over medium-high. Lightly brush with ghee.

  2. 2

    Pour 1/3 cup batter onto the hot surface. Spread with the back of a spoon in a thin circle, ~8 inches across.

  3. 3

    Drizzle ghee around the edges and scatter sliced onions on top. Cook until the bottom turns golden and crispy, ~2 minutes.

  4. 4

    Fold the dosa in half or roll it. Transfer to a plate.

  5. 5

    Mix sambar powder with remaining ghee and chili flakes. Drizzle over the warm dosa.

  6. 6

    Serve immediately with coconut chutney on the side.

Tools you’ll need

  • non-stick skillet or dosa griddle, 10-12 inches
  • spatula or dosa spreader
  • spoon
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.