Crispy Garlic Parmesan Cauliflower
Roasted cauliflower florets tossed with garlic powder and melted Parmesan cheese until golden and crispy. Serve alongside fresh arugula for a light, satisfying side or vegetarian main.
- Total time
- 20 min
- Servings
- 2
- Calories
- 185
- Protein
- 12g
simplequickamericanvegetariancrispytenderweeknightside
Ingredients
- 1 medium head cauliflower, cut into florets
- 2 tbsp olive oil
- ½ cup Parmesan cheese, finely grated
- 1 tsp garlic powder
- 1 pinch salt and black pepper to taste
- 2 cups arugula, fresh
Instructions
- 1
Toss cauliflower florets with olive oil, salt, and pepper on a sheet pan.
- 2
Spread in a single layer and roast at 425°F for 12 minutes, stirring once.
- 3
Mix Parmesan and garlic powder in a small bowl, then sprinkle over hot cauliflower.
- 4
Toss gently until cheese coats the florets and crisps, about 1 minute.
- 5
Serve cauliflower warm alongside fresh arugula.
Tools you’ll need
- sheet pan
- small bowl
- oven
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
