Custrd is out on the App Store — Download it free →
Back to recipes

Crispy Garlic Chicken & Rice — Cơm Gà Chiên

Vietnamese fried chicken with crispy garlic skin over jasmine rice and a bright lime squeeze. Ready in under 25 minutes with minimal cleanup.

Total time
25 min
Servings
2
Calories
520
Protein
38g
Crispy Garlic Chicken & Rice — Cơm Gà Chiên
satisfyingcasualvietnamesechickencrispytenderjuicyweeknight

Ingredients

  • 4 pieces (about 1.5 lb) bone-in, skin-on chicken thighs
  • 1.5 cups jasmine rice, cooked
  • 6 cloves garlic cloves, minced
  • 2 tbsp fish sauce
  • 1 whole (cut into wedges) lime
  • 2 stalks scallions, sliced

Instructions

  1. 1

    Pat chicken dry with paper towels. Season generously all over with salt and black pepper.

  2. 2

    Heat 2 tbsp neutral oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  3. 3

    Place chicken skin-side down in the pan without moving. Sear 8–9 minutes until skin is golden brown and crispy.

  4. 4

    Flip chicken and cook 6–7 minutes more until the internal temperature hits 165°F at the thickest part.

  5. 5

    Push chicken to the side. Add minced garlic to the empty space and stir constantly for 60 seconds until fragrant.

  6. 6

    Pour fish sauce over the chicken and toss gently to coat. Divide rice and chicken between plates, top with scallions and serve with lime wedges.

Tools you’ll need

  • large skillet (12-inch cast iron or stainless steel)
  • paper towels
  • instant-read thermometer
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.