CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Garlic Chicken Banh Mi

Juicy pan-seared chicken with a punchy mayo-sriracha spread, pickled daikon, fresh veggies, and toasted baguette. Comes together in 20 minutes—pure vibes.

Total time
20 min
Servings
2
Calories
520
Protein
36g
Crispy Garlic Chicken Banh Mi
freshquicksatisfyingvietnamesechickencrispyjuicytender

Ingredients

  • ½ lb boneless, skinless chicken breasts
  • 1 loaf (about 12 inches) baguette
  • 3 tbsp mayonnaise
  • 1 tbsp sriracha
  • ½ cup pickled daikon & carrot
  • ½ medium cucumber, sliced thin
  • 1 small fresh red chili pepper, thinly sliced
  • ½ cup loosely packed fresh cilantro & lettuce leaves

Instructions

  1. 1

    Pat chicken dry. Season generously with salt and black pepper on both sides.

  2. 2

    Heat 1 tbsp oil in a skillet over medium-high until it shimmers. Sear chicken 6–7 minutes per side without moving until golden and cooked through (165°F).

  3. 3

    Slice baguette in half lengthwise. Toast cut-side down in the same skillet until golden, about 90 seconds per side.

  4. 4

    Stir mayo and sriracha together. Spread on both baguette halves.

  5. 5

    Slice chicken against the grain. Layer on bottom half: lettuce, chicken, pickled daikon, cucumber, chili, cilantro.

  6. 6

    Close the sandwich. Cut in half and serve immediately.

Tools you’ll need

  • 12-inch skillet or cast-iron pan
  • cutting board
  • sharp knife
  • meat thermometer (optional but recommended)
  • small bowl for mayo-sriracha mix

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.