CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Fried Catfish with Hot Honey

Golden, crunchy catfish fillets fried until the edges curl, finished with a drizzle of spicy hot honey. Serve with creamy slaw or corn bread for the full Southern plate.

Total time
20 min
Servings
2
Calories
520
Protein
36g
Crispy Fried Catfish with Hot Honey
comfortsatisfyingsoutherncatfishcrispytenderweeknightcomfort-food-night

Ingredients

  • 1 lb (about 4 fillets) catfish fillets
  • ¾ cup all-purpose flour
  • ¼ cup cornmeal
  • 2 tbsp cajun seasoning
  • 3 tbsp honey
  • 1 tbsp hot sauce (Frank's or similar)

Instructions

  1. 1

    Mix flour, cornmeal, cajun seasoning, salt, and pepper in a shallow bowl.

  2. 2

    Pat catfish dry with paper towels, then dredge both sides in the flour mixture.

  3. 3

    Heat 0.5 inch neutral oil in a 12-inch skillet over medium-high until a pinch of flour sizzles instantly.

  4. 4

    Fry catfish 3-4 minutes per side without moving until golden brown and edges curl. Drain on paper towels.

  5. 5

    Whisk honey and hot sauce in a small bowl until combined.

  6. 6

    Drizzle hot honey over fried catfish. Serve immediately.

Tools you’ll need

  • shallow bowl
  • paper towels
  • 12-inch skillet or cast iron
  • instant-read thermometer (optional)
  • small bowl
  • slotted spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Southern recipes →