CookSnap is coming soon — Join the waitlist →

Crispy Faworki (Polish Fried Pastries)

Golden, paper-thin fried ribbons dusted with powdered sugar—a beloved Polish treat. These are surprisingly simple to make at home and taste best served warm.

Total time
45 min
Servings
4
Calories
410
Protein
7g
Crispy Faworki (Polish Fried Pastries)
indulgentfestivepolishvegetariancrispylightflakyholiday

Ingredients

  • 2 cups all-purpose flour
  • 3 whole eggs
  • ½ cup sour cream
  • ½ tsp salt
  • 1 tsp vanilla extract
  • 2 cups vegetable oil for frying
  • ½ cup powdered sugar
  • 1 tsp lemon zest (optional)

Instructions

  1. 1

    Whisk together eggs, sour cream, vanilla, and salt in a bowl until smooth.

  2. 2

    Add flour gradually, stirring until a soft, sticky dough forms.

  3. 3

    Knead dough on a lightly floured surface for 3 minutes until smooth.

  4. 4

    Wrap in plastic and rest at room temperature for 20 minutes.

  5. 5

    Heat oil in a heavy pot to 350°F. Use a thermometer to check; oil should shimmer.

  6. 6

    Divide dough into 8 pieces. Roll one piece paper-thin on a floured surface.

  7. 7

    Cut dough into 3-inch strips. Create a small slit in the center of each.

  8. 8

    Slide strips gently into oil. Fry 1–2 minutes per side until golden and puffy.

  9. 9

    Remove with a slotted spoon and drain on paper towels. Repeat with remaining dough.

  10. 10

    Combine powdered sugar and lemon zest in a shallow bowl.

  11. 11

    Dust warm faworki generously with powdered sugar. Serve immediately.

Tools you’ll need

  • medium mixing bowl
  • whisk
  • 9-inch rolling pin
  • lightly floured work surface
  • sharp knife or pastry cutter
  • heavy-bottomed pot (3-quart minimum)
  • instant-read thermometer
  • slotted spoon
  • paper towels
  • shallow bowl for dusting

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.