CookSnap is coming soon — Join the waitlist →

Crispy Erbazzone with Fried Egg

Buttery, crispy-edged spinach and herb pie from Reggio Emilia, topped with a runny fried egg. Ready in 25 minutes using phyllo as a shortcut—no yeast dough needed.

Total time
25 min
Servings
2
Calories
520
Protein
22g
Crispy Erbazzone with Fried Egg
comfortcozyitalianvegetariancheesecrispytenderflaky

Ingredients

  • 10 oz frozen spinach, thawed and squeezed dry
  • ¾ cup ricotta
  • ½ cup pecorino romano, grated
  • 6 sheets phyllo dough sheets
  • 4 tbsp butter, melted
  • 2 tbsp fresh parsley, chopped
  • ¼ tsp nutmeg, freshly grated
  • 2 whole eggs

Instructions

  1. 1

    Mix spinach, ricotta, pecorino, parsley, nutmeg, and a pinch each of salt and pepper in a bowl until combined.

  2. 2

    Brush a 10-inch skillet with melted butter. Layer 3 phyllo sheets, brushing butter between each, letting edges overhang.

  3. 3

    Spread spinach mixture onto phyllo. Fold overhanging edges over filling. Layer remaining 3 phyllo sheets on top, brushing butter between each.

  4. 4

    Cook over medium heat for 8 minutes until the bottom is golden and crispy. Transfer skillet to a 400°F oven.

  5. 5

    Bake for 10 minutes until the top is golden and edges curl slightly.

  6. 6

    Push erbazzone to the side. Add a pinch of butter to the skillet and crack both eggs into the open space. Cook until whites set, yolks still jiggle, ~3 minutes.

  7. 7

    Serve directly from the skillet, cutting the erbazzone in half and sliding an egg onto each portion.

Tools you’ll need

  • 10-inch cast iron or nonstick skillet
  • medium mixing bowl
  • box grater or microplane
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.