CookSnap is coming soon — Join the waitlist →
Back to recipes

Herb & Cheese Skillet Pie

Erbazzone reimagined as a fast stovetop skillet pie: tender greens, ricotta, and Parmigiano-Reggiano in buttery pastry. Ready in under 20 minutes.

Total time
20 min
Servings
2
Calories
520
Protein
18g
Herb & Cheese Skillet Pie
comfortrusticitalianvegetariancheeseflakytendercreamy

Ingredients

  • 1 sheet puff pastry sheet (thawed)
  • 4 cups fresh spinach and chard, roughly chopped
  • ¾ cup ricotta cheese
  • ½ cup Parmigiano-Reggiano, grated
  • 3 tbsp butter
  • 3 tbsp fresh parsley and chives, chopped
  • ¼ tsp nutmeg, freshly grated

Instructions

  1. 1

    Melt 2 tbsp butter in a 10-inch nonstick skillet over medium heat, then add greens.

  2. 2

    Cook greens, stirring occasionally, until wilted and any liquid evaporates, ~4 minutes.

  3. 3

    Stir in ricotta, Parm, herbs, nutmeg, salt, and pepper until combined. Remove from heat.

  4. 4

    Lay puff pastry sheet directly over the greens mixture, tucking edges down into the pan.

  5. 5

    Dot pastry top with remaining 1 tbsp butter, then return pan to medium heat.

  6. 6

    Cook until pastry edges are golden and crispy and you hear a gentle sizzle, ~8 minutes.

Tools you’ll need

  • 10-inch nonstick skillet
  • wooden spoon or spatula
  • grater (for Parm and nutmeg)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.