CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Italian Cheese & Greens Torta Salata

Flaky, buttery pastry wrapped around creamy ricotta, spinach, and melted cheese. A rustic Italian savory pie that's elegant enough for dinner yet simple enough for weeknights.

Total time
45 min
Servings
4
Calories
385
Protein
16g
Italian Cheese & Greens Torta Salata
comfortelegantitalianvegetariancheeseflakycreamyweeknight

Ingredients

  • 1 sheet (thawed) frozen puff pastry
  • 4 cups (packed) fresh spinach
  • 1 cup ricotta
  • ¾ cup mozzarella, shredded
  • ½ cup parmesan, grated
  • 1 pinch each salt, black pepper, and nutmeg to taste

Instructions

  1. 1

    Preheat oven to 400°F. Line a 9-inch tart pan or baking sheet with parchment paper.

  2. 2

    Wilt spinach in a large skillet over medium heat, stirring occasionally, until completely dry, ~5 minutes.

  3. 3

    Let spinach cool slightly, then roughly chop and transfer to a bowl.

  4. 4

    Stir ricotta, mozzarella, parmesan, salt, pepper, and nutmeg into the spinach until well combined.

  5. 5

    Lay puff pastry sheet on prepared pan. Spread spinach-cheese filling evenly, leaving 1-inch border.

  6. 6

    Fold pastry edges over filling, pleating as you go. Some filling will show in the center.

  7. 7

    Bake until pastry edges are golden brown and center fills have set, 20-25 minutes.

  8. 8

    Cool 5 minutes. Slice into wedges and serve warm or at room temperature.

Tools you’ll need

  • 9-inch tart pan or baking sheet
  • parchment paper
  • large skillet
  • large mixing bowl
  • spatula or wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.