CookSnap is coming soon — Join the waitlist →

Crispy Dutch Kibbeling in 20 Minutes

Bite-sized whitefish chunks fried golden-crisp in a light beer batter, served with tartar sauce and lemon. Pure Dutch street food nostalgia, ready in under 20 minutes.

Total time
20 min
Servings
2
Calories
520
Protein
32g
Crispy Dutch Kibbeling in 20 Minutes
casualsatisfyingdutchfishcrispytenderweeknightcasual

Ingredients

  • 1 lb whitefish (cod, haddock, or pollock), cut into bite-sized chunks
  • ¾ cup all-purpose flour
  • ½ cup light beer (lager or pilsner)
  • 2 cups neutral cooking oil for frying
  • ½ cup tartar sauce or mayo mixed with lemon juice
  • 1 whole lemon, cut into wedges

Instructions

  1. 1

    Pat fish chunks dry with paper towels. Season generously with salt and pepper.

  2. 2

    Whisk flour, beer, 0.25 tsp salt, and 0.25 tsp pepper until smooth and thick like pancake batter.

  3. 3

    Heat oil in a heavy pot or deep skillet to 350°F (use a thermometer). Oil should shimmer and shimmer at the surface.

  4. 4

    Working in batches, dip fish chunks into batter to coat fully, then slide into hot oil. Fry 2–3 minutes until golden-brown and crispy.

  5. 5

    Remove with a slotted spoon and drain on paper towels. Keep warm while frying remaining batches.

  6. 6

    Serve hot with tartar sauce and lemon wedges on the side.

Tools you’ll need

  • heavy pot or deep skillet (3–4 quart)
  • instant-read thermometer
  • slotted spoon
  • paper towels
  • whisk
  • shallow bowl for batter

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.