Custrd is out on the App Store — Download it free →
Back to recipes

15-Min Crispy Dolmades with Lemon

Jarred grape leaves stuffed with herbed rice and pan-fried until crispy—no steaming required. Squeeze fresh lemon over warm dolmades for bright, briny, totally craveable Greek comfort.

Total time
15 min
Servings
2
Calories
280
Protein
6g
15-Min Crispy Dolmades with Lemon
comfortsimplegreekvegetarianvegandairy-freevegetariancrispy

Ingredients

  • 1 jar (about 16 oz) jarred grape leaves
  • 1 cup cooked white rice
  • ¼ cup fresh dill and parsley (chopped)
  • 1 whole lemon (zested + juiced)
  • 3 tbsp olive oil
  • 1 lemon lemon wedges (for serving)

Instructions

  1. 1

    Drain and rinse grape leaves gently. Combine rice, dill, parsley, lemon zest, and half the lemon juice in a bowl.

  2. 2

    Place one leaf flat, shiny-side down. Add 1 tbsp rice mixture to the center, fold in sides, roll tight.

  3. 3

    Heat olive oil in a skillet over medium-high until shimmer appears, about 90 seconds.

  4. 4

    Pan-fry dolmades seam-side down in batches, 2–3 minutes per side until golden and crispy.

  5. 5

    Transfer to a plate. Squeeze remaining lemon juice over warm dolmades.

  6. 6

    Serve hot with lemon wedges on the side.

Tools you’ll need

  • medium bowl
  • 12-inch skillet
  • cutting board
  • lemon juicer

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.